sere serpe ne demek?

  1. Serbest, rahat bir biçimde, çekinmeden

    Boş evde sere serpe dolaşıyorum.

    R. H. Karay
  2. Sıkışık olmadan, rahatça, kollarını bacaklarını açarak yatmak.

    Evin içinde rahatça, sere serpe oturduk.

  3. (en)Zarf.

sere

  1. Açık duran başparmağın ucundan işaret parmağının ucuna kadar olan uzaklık, sele.
  2. Başparmağın ucundan şehadet parmağının ucuna kadar germek suretiyle hasıl olan uzunluk ölç--uşu--. Karıştan küçüktür ve dört sere bir arşın sayılırdı.
  3. (en)Dry; withered; no longer green; applied to leaves.
  4. (en)Sequence of plant communities that successively follow one another in the same habitat from the pioneer stage to a mesic climax.
  5. (en)Dry; withered.
  6. (en)The series of communities that follow one another in a natural succession, as in the change from a bare field to a mature forest.
  7. (en)Same as Sear.
  8. (en)Developmental series of communities a chain of seral stages containing the initial , one or more transitional stages, and a single climax stage.
  9. (en)Claw; talon.
  10. (en)Survival, evasion, resistance, and escape.

sereb

  1. (C.: Esrab) Yer altında olan ev.

Türetilmiş Kelimeler (bis)

sereserebserebeserebellarserebellar ataksiserebellar hipoplaziserebellarisserebellifügalserebellipetalserebellitserser çavuşser esvabıser gulam ı bakıser hafiyeserpedenlikserpelemeserpelemekserpençeserpeneserpenekserpenkserpentserpent charmerserpent eelserpserpanserpantinserpantinli boylerserpaş
Yorumunuzu ve bilginizi paylaşın